PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK37054.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 320aa    MW: 35732.2 Da    PI: 6.0854
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK37054.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.21.1e-10188231548
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                 kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  KFK37054.1 188 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 231
                 8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-13184248IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.622186238IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.42E-11188242No hitNo description
Gene3DG3DSA:1.20.5.1704.0E-13188239No hitNo description
PfamPF001704.5E-9188232IPR004827Basic-leucine zipper domain
CDDcd147038.28E-24189239No hitNo description
PROSITE patternPS000360191206IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MAQLPPKIPN MTSHWPDFSS QRLSPFSTTT APAPAPASVA EAQNPSWVDE FLDFSASRRV  60
NHRRSISDSI TFLEAPAVAS HDIIGNQHFD RFDDEQFMLM FTDEDLHNPS HNNNNNVGPT  120
GSSSNTSTPS DHNSINDDNK EPPCDHNVEN NFNNHNEVES QCKAEPDDGT TSNNNSGDSS  180
GNRIIDPKRV KRILANRQSA QRSRVRKLQY ISELERSVTS LQAEVSVLSP RVAFLDHQRL  240
LLNVDNSALK QRIAALAQDK IFKDAHQESL KREIERLRQV YNQQSLNKME NVNHSPATGA  300
GATSAVDMKS TIEKEQLLNV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411496.11e-179hypothetical protein EUTSA_v10016923mg
SwissprotF4IN231e-161BZP34_ARATH; Basic leucine zipper 34
TrEMBLA0A087H4K20.0A0A087H4K2_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.4__2390__AT2G42380.21e-159(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-132bZIP family protein